SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020372 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020372
Domain Number 1 Region: 24-104
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000353
Family DEATH effector domain, DED 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020372   Gene: ENSCPOG00000019827   Transcript: ENSCPOT00000020641
Sequence length 330
Comment pep:known scaffold:cavPor3:scaffold_80:4067623:4082490:1 gene:ENSCPOG00000019827 transcript:ENSCPOT00000020641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSGSTPAPSWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAAGGLA
RARSGLELLLELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYNFGTS
SSSSKRTEGSCRRHHQSSSSSSTSDSQQGQWNTDSPPTKRQRRSRGRPSGGARRRRRGGP
PAPQQQQEPTRPTSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQLDVFGQAT
AVLRSRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFLTEALREAVGREAVRLL
VSVDEADYEAGRRRLLLMEEDGGRRPSEAS
Download sequence
Identical sequences H0WBK6
ENSCPOP00000020372 XP_005001360.1.53824 ENSCPOP00000020372 10141.ENSCPOP00000020372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]