SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020582 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020582
Domain Number 1 Region: 463-566
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-24
Family PDZ domain 0.0098
Further Details:      
 
Domain Number 2 Region: 21-123
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-22
Family PDZ domain 0.0000196
Further Details:      
 
Domain Number 3 Region: 245-359
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-17
Family PDZ domain 0.046
Further Details:      
 
Domain Number 4 Region: 736-846
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000283
Family Nucleotide and nucleoside kinases 0.0011
Further Details:      
 
Domain Number 5 Region: 567-634
Classification Level Classification E-value
Superfamily SH3-domain 0.00000015
Family SH3-domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020582   Gene: ENSCPOG00000021062   Transcript: ENSCPOT00000020498
Sequence length 1150
Comment pep:known scaffold:cavPor3:scaffold_21:20483598:20527342:1 gene:ENSCPOG00000021062 transcript:ENSCPOT00000020498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIGFPEPENLEFCKSHWLFAAPGMEELKWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENG
ETSIVISDVLPGGPADGLLKENDRVVMVNGTSMEGVLHSFAVQQLRKSGKVAAIVVKRPR
IVQVAPLQGSPALSHDDRAFDVMDELDNRSYRSGYSERSPHGSREEFHRSWEGSLDRGRG
HHRYQDQDRSRGQSLERGLDRDDRRARDRSRGRSSHRPAYGKDSPSSGNRRQVQPESRYE
RPRSRSQEHFQSHSPSPEPRGQPASDGHIGVLLTKSKANEEYGLRLGSQIFIKEMTKTGL
ASKDGNLHEGDLVLKINGTVTENMSLIDAGKLIEKSRGKLQLVVFRDSKQTLINIPSLND
SDSELEDISEMESVRSFSPEERRQQVRCYVFYSSPETLTCSREDAPPGRLSRMGATPTPF
KASGDSAAVATETKKEPRSQEEPPAPLPRTTPRTFLRPSPEDEAIYGPDTKMVKFKKGDS
VGLRLAGGNDVGLFVAGIQEGTAAEEAGLQEGDQILKVNTQDFRGLVREDAVLYLLEIPK
GDMVTILVQSRADVYRDILACGRGDSFFIRAHFECEKESPQSLAFSRGEVFRVVDTLYDG
KLGHWLAVRIGNELEKGLIPNRSRAEQMASVQNGQRDNAGDRADFWRMRGQRSGAKKNLR
KSREDLTAAVSVSTKFPAYERVLLREAGFKRPVVLFGPIADVAMEKLTNELPDLFQTAKT
EPKDAGSEKSTGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQG
VKIMRQRLNPSSNKSSRKLYDQANKLKKTCAHLFTATINLNSANDSWFGSLKDTIQNQQG
QAVWVSEGKIEGMDDDPDDHMSYLTALGADYLSCDSRLISDFEDTDGEGGAYTDNELDEP
AEEPLVSSITRSSEPVQHEESIRKLSPEPPAQMRRAASRDQLRDSSPPPAFKPEPPKIKP
QNREESYDFSKSQEYKSNPSAMGGDDFPRTTARGCPPPVAAKPSFGRSVQKPSVPVPAPE
SEEVEERIEDQENAPKSVLGKVKIFEKMDHKARLQRLQELQEAQNAQIEIAQKHPSIYAV
PIKAPKPDAGLPQHTSSRPPEPQKGPSRFSQNMHGSYGSDAEEEEYRQQLAEHSKRSYFG
QPAKYRDTEL
Download sequence
Identical sequences 10141.ENSCPOP00000020582 ENSCPOP00000020582 ENSCPOP00000020582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]