SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020644 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020644
Domain Number 1 Region: 74-504
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.53e-109
Family L-arabinose binding protein-like 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000020644
Domain Number - Region: 514-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0129
Family TNF receptor-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020644   Gene: ENSCPOG00000027516   Transcript: ENSCPOT00000023160
Sequence length 852
Comment pep:known scaffold:cavPor3:scaffold_42:14037548:14054354:-1 gene:ENSCPOG00000027516 transcript:ENSCPOT00000023160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YWIFLRFFFLLYEILICSHTVNSFCMYLLSIKKLTDEYNLDNSGCEFTIIFLQTPIDELA
LQVIMNYLMHLPNSYQNVLAFIFAIEEINKNPHLLPNISLGYEFHNYLYSHWRVLESSLT
LLTGQKDIPNYSCRRENRSVAVLTGNSWATSTQVGTLLELYKFPQVTFGSFDPVLRDNGQ
FPSLYQAAPRDTSLALAMVSLLLHFRWTWVGLVITEGHKGLQFMSDLTGEMDRNKVCVAF
VKIASTPIVSYMALSKEYVILTKETSQVSVVILYYDTDILSDVDYNIEQHLLTGKIWVTN
SQWHADMTGKNFILNSFHGTFIFSNHHEEISGFKTFVQEVNPSKYPEDFYLTMFWFNNFH
CSFSDADCSLKDCTPNASLAWLPVNHFDTTMTDWSHNVYNAVYAVAHALHEMLHQQAQWP
PLGKKEVMVSSPWQLHSFLKNTQFNNPAGDHVSLNDRRKEDINYDILNFWNFPEGLRLKV
KLGTFTPHVPHGQQLSLSDEKIEWATENAEMPLSVCSDSCHPGFRKSSQEGKPACCFDCI
PCPENEITNDTDMEQCVKCPDDQYATIQQDHCLQKSVIFLAHEDLMGKILTGTALSLTLL
TAAVLGLFVKHQDTPIVKANNRALSYTLLISLTFCFLCSLLFIGRPNTATCILQQTTFAI
VFTVAVSTVLTKTITVVLAFKITAPGRRMRHLLVSGAPNYIIPICTLVQLTLCGIWMGTN
PPYLDTDAHSEHGHIIIVCNKGSLTAFYCVLGYLGSLALLSFTVAFLAKNLPDTFNEAKF
LTFSMLVFCSVWVTFLPVYHSSKGKVMVAMEIFSILVSSAGLLGFIFAPKCYIILLRPER
NSLHGFRAKTIF
Download sequence
Identical sequences 10141.ENSCPOP00000020644 ENSCPOP00000020644 ENSCPOP00000020644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]