SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020709 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020709
Domain Number 1 Region: 575-764
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.29e-55
Family Nucleotide and nucleoside kinases 0.00000000796
Further Details:      
 
Domain Number 2 Region: 346-444
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-32
Family PDZ domain 0.000017
Further Details:      
 
Domain Number 3 Region: 470-603
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-31
Family SH3-domain 0.00000393
Further Details:      
 
Domain Number 4 Region: 97-196
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-28
Family PDZ domain 0.0000223
Further Details:      
 
Domain Number 5 Region: 199-294
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-26
Family PDZ domain 0.0000183
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000020709
Domain Number - Region: 26-50
Classification Level Classification E-value
Superfamily L27 domain 0.000859
Family L27 domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020709   Gene: ENSCPOG00000020815   Transcript: ENSCPOT00000019586
Sequence length 767
Comment pep:known scaffold:cavPor3:scaffold_61:9401137:9425108:1 gene:ENSCPOG00000020815 transcript:ENSCPOT00000019586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRPRAPRSALWLLAPPLLWWAPPLLTVLHSDLFQALLDILDYYEVSISEGQKYRYQDE
DTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGF
SIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEAL
KEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEG
GAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAP
PDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIH
RGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRSASHEQAAI
ALKNAGQTVTIIAQYKPEEYSRFELKMQTCGKQLMNSSLGSGTASLRSNTKRGFYIRALF
DYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERR
EWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPD
KFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVR
EVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRA
TKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL
Download sequence
Identical sequences ENSCPOP00000020709 10141.ENSCPOP00000020709 ENSCPOP00000020709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]