SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020964 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020964
Domain Number 1 Region: 27-82
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000207
Family TNF receptor-like 0.004
Further Details:      
 
Domain Number 2 Region: 82-120
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000495
Family TNF receptor-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020964   Gene: ENSCPOG00000021076   Transcript: ENSCPOT00000019499
Sequence length 155
Comment pep:novel scaffold:cavPor3:scaffold_42:11568517:11579042:1 gene:ENSCPOG00000021076 transcript:ENSCPOT00000019499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANQYGHLLIMTMSLLFQVTVAISVTSCNPGECLSDDLCCQCCPAGHFVTKLCQENHGIVK
CAPCEPGTFMAYPNLENICFLCSQCQKDQEEVSNCSSTTNRQCQCKEGYYCDSENCVEHC
FRCSRCHCSESGGVLEPCNPKANTICAKMNQESGK
Download sequence
Identical sequences ENSCPOP00000020964 10141.ENSCPOP00000020964 ENSCPOP00000020964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]