SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000021098 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000021098
Domain Number 1 Region: 140-201
Classification Level Classification E-value
Superfamily Homeodomain-like 8.77e-17
Family Homeodomain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000021098   Gene: ENSCPOG00000023314   Transcript: ENSCPOT00000023473
Sequence length 260
Comment pep:known scaffold:cavPor3:scaffold_20:5358679:5360452:1 gene:ENSCPOG00000023314 transcript:ENSCPOT00000023473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPGPGAPAAAHAASMFQLPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEA
LNKNESVLRARAIVAFHGGNYRELYHILETHKFTKESHAKLQALWLEAHYQEAEKLRGRP
LGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATG
LTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLAQGSGRALRAESEGTPELLGVASSPAASL
SSKAATSAISITSSDSECDI
Download sequence
Identical sequences ENSCPOP00000021098 10141.ENSCPOP00000021098 ENSCPOP00000021098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]