SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000021167 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000021167
Domain Number 1 Region: 4-454
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.23e-102
Family L-arabinose binding protein-like 0.0000112
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000021167
Domain Number - Region: 482-528
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0306
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000021167   Gene: ENSCPOG00000021293   Transcript: ENSCPOT00000028435
Sequence length 817
Comment pep:known scaffold:cavPor3:scaffold_175:1535216:1562012:-1 gene:ENSCPOG00000021293 transcript:ENSCPOT00000028435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFERPGDVVLGGSFCILHFYNAVSLDFTTLPAGLPSSSVSSWGYRVAQSFVFAVEEINNS
THLLPNLTLGFSIRNSGDSVHGAMHETMAFLTGQEDPVPNYSCHRGPPQAAMVGDTRSAL
SVAMARLLGLYKFPQVSYASTLPSLSDKNQFPSFLRTRASDLTTSYAMTQLVLHLGWSWV
GILAQDDDFGQQAGNLAREELSQAGVCIEFHLHIPSRQSPEKIDANVRKMEKSTATGVLV
FLSNSNIQLILHRLVGNRVLGQVWVSETLVHTVIALATPGASWVLQGAFGLKLRSSHAHG
LSEFFAHLHPSRTPEDMFLRRFWEATFGCRWPHSNDTEPSDMQLCSGNETLRDHEYPFQE
VSRLEAAYPAVYSIAHALQDMVLCENENRECGDPVHFQPWQLLHPLRKVSFQTPDGTHIM
FDANGDLVTKFDVLQGQWSPEGQFHFVHIGKMDPHPSLENTMLFVQSEKALGSLFVEREV
PSSVCSTSCEPGSSQIPQQGAPHCCFECQPCPEGQFADQKDMKSCLQCPEEQYSSQSKDY
CLPRTETFLAFDEPLGLVLTVVSLSLASLACLVLGVFLWFQQTPVVRANNRALSYVLLVS
LTLCALSTLLFLGRPSPTTCLLRQITFAVVFTVAVSCVLAKTLTVVLAFRATKPGQRVHM
CLGPSASSFVVLVASLVQIILCGIWLGTSPPFPHRDTASEPGHLVLQCHEGSGIAFSCVL
GYLGLLAIGTFSVAFLARGLPDTFNETKFLTFSMLLFCSVWTAFLPLYFSARGKATVAVE
VFSILASTAGLLGGIFFPKCYLILLKPERNTPPSLRT
Download sequence
Identical sequences ENSCPOP00000021167 10141.ENSCPOP00000021167 ENSCPOP00000021167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]