SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000354 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000354
Domain Number 1 Region: 488-653
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 8.37e-72
Family A middle domain of Talin 1 0.0000000331
Further Details:      
 
Domain Number 2 Region: 753-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.89e-54
Family I/LWEQ domain 0.00000024
Further Details:      
 
Domain Number 3 Region: 2295-2486
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.69e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 658-782
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.54e-48
Family I/LWEQ domain 0.000000528
Further Details:      
 
Domain Number 5 Region: 1841-1973
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.57e-46
Family VBS domain 0.000000445
Further Details:      
 
Domain Number 6 Region: 1225-1361
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.51e-38
Family VBS domain 0.015
Further Details:      
 
Domain Number 7 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-34
Family Second domain of FERM 0.000000558
Further Details:      
 
Domain Number 8 Region: 1075-1207
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.45e-27
Family VBS domain 0.031
Further Details:      
 
Domain Number 9 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 2e-25
Family Third domain of FERM 0.00000822
Further Details:      
 
Domain Number 10 Region: 1410-1555
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000562
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 79-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000271
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 12 Region: 1695-1814
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000298
Family VBS domain 0.023
Further Details:      
 
Domain Number 13 Region: 2010-2132
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000011
Family VBS domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000354
Domain Number - Region: 949-1042
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000628
Family I/LWEQ domain 0.0041
Further Details:      
 
Domain Number - Region: 1598-1658
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00314
Family VBS domain 0.078
Further Details:      
 
Domain Number - Region: 2100-2227
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0458
Family I/LWEQ domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000354   Gene: ENSCPOG00000000403   Transcript: ENSCPOT00000000406
Sequence length 2541
Comment pep:known scaffold:cavPor3:scaffold_27:16057268:16084489:-1 gene:ENSCPOG00000000403 transcript:ENSCPOT00000000406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEALAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQMGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDTLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATDDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHASSTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLERDLQEVKAAARDGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRVVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGEAIATASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQGINQLDEGPMGEPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRV
QELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAYHPEVAPEVRLRALHFGRECANGYLELLDHVLLTLQKPNPELKQQLTGHSKRVAGSV
TELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAG
NAVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARK
KLAQIRQQQYKFLPTELRDEH
Download sequence
Identical sequences 10141.ENSCPOP00000000354 XP_003470907.1.53824 ENSCPOP00000000354 ENSCPOP00000000354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]