SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000508 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000508
Domain Number 1 Region: 349-436
Classification Level Classification E-value
Superfamily DEATH domain 2.27e-25
Family DEATH domain, DD 0.0000207
Further Details:      
 
Domain Number 2 Region: 101-144
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000000654
Family TNF receptor-like 0.0003
Further Details:      
 
Domain Number 3 Region: 145-197
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000011
Family TNF receptor-like 0.00026
Further Details:      
 
Domain Number 4 Region: 44-100
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000348
Family TNF receptor-like 0.0000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000508   Gene: ENSCPOG00000000579   Transcript: ENSCPOT00000000584
Sequence length 445
Comment pep:novel scaffold:cavPor3:scaffold_107:858198:870284:1 gene:ENSCPOG00000000579 transcript:ENSCPOT00000000584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPTVSGLLLPLVLLALLVWIHSSGVIGLVPPFGDREKRDSLCPQGKYSHPKNNSICCT
KCHKGTYLYNDCLGPGLDTDCRECENGTFTSSENYHRKCFSCSRCREELFQVELSSCTVD
RDTVCGCGENQFRDYFSSKHFQCLNCSLCLNGTVIIPCQERQNTVCTCHTGFFPKGSECV
SCSKCKQDSECTKVCPRPDPVIKPPQDSGTTVLLPLVIFLGLCLLSIFFIILMCRYPRWK
PKLYSIVCGKSAPVKETKRRPRSRPATDAVSSLFQGELEGISTKPLTTTKDFTVWSDFRD
AAPYSVVAPPSVGPEPVFSLANTSEPIHTAARKRQDGAGAQVLDAEPTTLYAVVDGVPPT
RWKEFMRRLGLSEHEIERLELQNPRCLREAHYSMLSAWRQRTPRREATLDLLGRVLRDMD
LQGCLEDILESMRPRPQSTRKARPR
Download sequence
Identical sequences ENSCPOP00000000508 ENSCPOP00000000508 10141.ENSCPOP00000000508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]