SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000768 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000768
Domain Number 1 Region: 282-481
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.83e-92
Family N-myristoyl transferase, NMT 0.00000000524
Further Details:      
 
Domain Number 2 Region: 101-281
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.4e-78
Family N-myristoyl transferase, NMT 0.000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000768   Gene: ENSCPOG00000000854   Transcript: ENSCPOT00000000860
Sequence length 482
Comment pep:known scaffold:cavPor3:scaffold_67:8914949:8944188:-1 gene:ENSCPOG00000000854 transcript:ENSCPOT00000000860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGESEAAVKPPAPPRPQMMEGNGNSHEHCSDCENEEDNSYIRGGLSPANDTGASETESA
QDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNT
HGPVEPDKDHVRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSP
EFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKL
RSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHL
SRNMTMQRTMKLYRLPETPKTAGLRPMERKDIPAVHQLLSRYLKQFHLTPVMSQEEVEHW
FYPQENIIDTFVVENASGEVTDFLSFYTLPSTIMNHPTHKSLKAAYSFYNVHTQTPLLDL
MSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLV
LQ
Download sequence
Identical sequences ENSCPOP00000000768 ENSCPOP00000000768 10141.ENSCPOP00000000768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]