SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001378 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001378
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 2.35e-50
Family Globins 0.000000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001378   Gene: ENSCPOG00000001523   Transcript: ENSCPOT00000001543
Sequence length 147
Comment pep:known scaffold:cavPor3:scaffold_71:5337899:5339176:1 gene:ENSCPOG00000001523 transcript:ENSCPOT00000001543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTAAEKSAILDLWGKVNVGEIGAEALGRLLVVYPWTQRFFEKFGDLSSASAIMSNAH
VKSHGAKVLASFSEGLKHLEDLKGTFAKLSELHCDKLHVDPENFRLLGNMIVIALAHHHP
SEFTPCTQAAFQKVTAGVANALAHKYH
Download sequence
Identical sequences H0UWE7
ENSCPOP00000001378 ENSCPOP00000001378 10141.ENSCPOP00000001378 XP_003465323.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]