SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001440 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001440
Domain Number 1 Region: 662-777,942-999
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000567
Family FAD/NAD-linked reductases, N-terminal and central domains 0.028
Further Details:      
 
Domain Number 2 Region: 460-566
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000867
Family N-acetyl transferase, NAT 0.025
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000001440
Domain Number - Region: 184-246
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000276
Family N-acetyl transferase, NAT 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001440   Gene: ENSCPOG00000001594   Transcript: ENSCPOT00000001615
Sequence length 1137
Comment pep:known scaffold:cavPor3:scaffold_8:6988141:7201617:-1 gene:ENSCPOG00000001594 transcript:ENSCPOT00000001615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILTSPRGKAEVVHCRRTESQDIYCIQKLIRKFTQKLFGRLNIIYLLEKANLAITLCND
REEIMAQATFLDYPNWNVATPEAWPSVFRELDSDIPCTPLNTLFLHLFVAVNEYSVGCCK
EIIRTVFKAVPDLHFIFLIVPSYMSLGSTLVTVFNPVGSVPCLTFNEDFAVYVCHRHSHY
PQLHIRKARVEDHDDLMPIFMRHDTVLKDTYGEYFLAELIEAQDQENHAVVCEVEGVAVG
FMSVCSRVNLRLLHECFDLGPFHGFCIPHPEDILEPPKEPRSADAALRADSQGTQRTAEK
PPVPASPEATGSTQENIEKVMEEPEPLSEAHSENASEIQDMDKLNLLSHITEQEYNASRW
SLASILLPEEPGRFRPVYRGDASVFCIQLFCIDEKYEARSLDFMNFVFSLFPGKNFCIIS
VPQLTPEFALIQNFVKVIPFDDCTLQHDLYVFHRAGLFKSITVRLANRADTPGVEQLLSS
LMLSQSILEDLAQYNEARRDPDGTPLQAFVAEVAEQVVGIAVIRNEMDIEYIRSHYNIED
FIYFNHHQRDEHGRLHHLALNPAFRHYTKFFLKEILRLGSKTCLYYPVYPQTREGKLQSP
YAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKAVSKDALGYALNHTNRKLTLEPKIT
VNARIVVVGASSVGISFLETLVFCSHLKFNNLTLISTHGLPGKKLLGSEQRKFLASDHCF
NDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVVSKDRAVPYDHLILCTGQQYQVPCPTGA
DISQHPTNREIPTSSKMHYSGQVPCNLFTLNDEDDCMKALTWIRRNSIATEGNVIVYGNT
IDAYTTVETLLNLGVRGTCIYLVHTPSKSTVTCINNYSVERAVEEALEAAGVTTFQDAIL
AQWNQGLKPDPICCASFTTPTKPFQLQCAMFFSFCEKNVDYETFKALNDACLVYDGRLVI
DTNFHTNDIAIRAAGPLTKFSNRYYANDWTHSNFSSKEVGFQLAATMLNLFDPTLEPVME
PPADLDRLIPMYKGAKIQGGILPGAYHYLHITKPAIPTALEVQRTQSDFGSEIVTGSAKA
GTYFWIHINKYKMVEDITCLSREPFPVSNYIRLFGQHEQALNDLCARYNSGRISDLY
Download sequence
Identical sequences ENSCPOP00000001440 ENSCPOP00000001440 10141.ENSCPOP00000001440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]