SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001994 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001994
Domain Number 1 Region: 264-524
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.64e-77
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 142-247
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-31
Family Kringle modules 0.00025
Further Details:      
 
Domain Number 3 Region: 43-83
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000204
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 4 Region: 82-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000204
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001994   Gene: ENSCPOG00000002198   Transcript: ENSCPOT00000002227
Sequence length 528
Comment pep:known scaffold:cavPor3:scaffold_11:2183717:2197915:-1 gene:ENSCPOG00000002198 transcript:ENSCPOT00000002227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWTPDFYDYSYDDDIQEENTNTSLTHMLLPGCLFWALCLCVLDPCQSNPCEHGGNCIITG
DTFSCRCQPPFSGNRCQNVETRCKNNRCGPGECLITQNPPYYRCACRHPYTGPDCSRVLP
VCRPNPCQNGGICSHHRRRSRFKCTCSDQFTGRFCEIGSDDCYVGDGYSYRGRVSRTVNQ
HTCLYWNSHLLLQENYNMFMEDAEGHGIGEHNFCRNPDGDQKPWCFIKANSEKVKWEYCD
VPACPAVDTDNPEQSPVGSPIQHLGFDSCGRTEVTARKIKRIYGGFKSTAGKHPWQASLQ
TSLPLTSSMPQGHFCGGALIHPCWVLTAAHCTNIKAKHLKVVLGDQDLKKTEFHEQTFRV
EKIIKYSCYNERDEIPYNDIALLKLKPVDGHCALESKYVKTVCLPDDSFPSGTECHISGW
GVTETGEGSRHLLDAKVKLIANTLCNSRRLYDQTIDDSMICAGNLQKPGQDTCQGDSGGP
LTCEKDGIYYVYGIVSWGQECGKKPGVYTQVTKFLSWIKTTMQNEAVF
Download sequence
Identical sequences ENSCPOP00000001994 ENSCPOP00000001994 10141.ENSCPOP00000001994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]