SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002075 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002075
Domain Number 1 Region: 28-125
Classification Level Classification E-value
Superfamily Snake toxin-like 1.24e-24
Family Extracellular domain of cell surface receptors 0.017
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000673
Family Extracellular domain of cell surface receptors 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002075   Gene: ENSCPOG00000002284   Transcript: ENSCPOT00000002316
Sequence length 289
Comment pep:known scaffold:cavPor3:scaffold_80:4640510:4643645:-1 gene:ENSCPOG00000002284 transcript:ENSCPOT00000002316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSARKADARAAIWTTGWLLLWPLLLHEGAQALECYSCVQRADDGCSPQKMKTVKCAAGV
EVCTEAVGAVETIHGQFSVAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLN
LTSRGLNPAGNESANQPNGAECYSCVGLSHEKCQGTVPPVVSCYNASDRVYKGCFDGNVT
LTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPL
VLLPPPATPAPSTPAPTTSVITSTPAPTTLTSTTKPTPAPTSQTLPHEV
Download sequence
Identical sequences ENSCPOP00000002075 ENSCPOP00000002075 10141.ENSCPOP00000002075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]