SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002104 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002104
Domain Number 1 Region: 938-1039
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-28
Family PDZ domain 0.0009
Further Details:      
 
Domain Number 2 Region: 547-675
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-23
Family Third domain of FERM 0.0052
Further Details:      
 
Domain Number 3 Region: 758-861
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-22
Family PDZ domain 0.019
Further Details:      
 
Domain Number 4 Region: 439-544
Classification Level Classification E-value
Superfamily Second domain of FERM 6.02e-21
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 5 Region: 1068-1174
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-20
Family PDZ domain 0.027
Further Details:      
 
Domain Number 6 Region: 343-433
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000266
Family First domain of FERM 0.035
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000002104
Domain Number - Region: 83-157
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000529
Family Protein kinases, catalytic subunit 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002104   Gene: ENSCPOG00000002317   Transcript: ENSCPOT00000002349
Sequence length 1298
Comment pep:novel scaffold:cavPor3:scaffold_62:4675583:4753841:1 gene:ENSCPOG00000002317 transcript:ENSCPOT00000002349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFHACVLAGSSQASVTLASALQVRGEALSEEEIWSLLSLAGERLLEDLRHDSCAYVVCPW
STLLSAAGSLSFQDHVSHLEAAPFKAPELLQGQSEDDHPDTSQQGHVYSLGMTLYWAAGF
RVPPSQPLRLHQPLHALLLAMCEDQPSRRCPLQAILEACRTHQEAVAVAPLLASLHVRQL
VGLVLGTIAKVERRMVREDICTQQGRSCLLRKRLQPPSGERPEVRAGYHLQLHRVSERNM
EAQSSGDPHWSSSAHSPCSPSENSALTGAAPLGGQAGQRLGSGAALRAEAEHSWSVTRQQ
GLLQRKAKFSRPEFLLLAAEAPVTLHLPGSVVTRKGKSYLALRDVCVVLLSGRCLEVKCD
MESTVGAVFDAVVSFANLGDATYFGLAYAKGKEFFFLDNETRLCKVAPEGWREQSLKTST
VTFTLFLRIKFFVSHCGLLLPSLTRHQFYLQLRQDILEERLRCDDDETLLRLGVLALQAE
FGSYPKEQAENKPYFQVEDYIPPTLIERMTALRAQVEVSEMHQLSSALWGADAELEFLRV
TQQLLEYGVLIHQVFPEKKRLEEEMALGVCSKGVIIYEVKNQSRVATLWFPWEEIGKIST
YRKKLTITSSLTGKKHTFVTDSAKTCTYLLGLCSAQHGFHAQTGSGPPPRLSAGRRKAVQ
TASLSPAHQASSKPLSWSQRLSCSENELFAPRMQDAVGGLLSMSLENFSSDGTKEAVGLG
VGRDPCAGQEQQDSACLMQKPRNCDRLLGPLAQGMCPGSQSSRRGSLTAELRRELVHVAL
QRDPHRGFGFVISEGEDVGQASPGIFISSVIPGGPAAKTKKIKPGGQILALNRISLDGFT
FAMAVRMIQNSPDHLELTVSQAEGVCGNAPREGKDGMATPGIFTPGVLSAGHQGSISSHV
QEQDGDPEEREMAQAQSPTPQQRPQHAPLPGQGAGTSPPPSPLETNSGEIYFVELVKEDG
TLGFSVTGGINTSVLHGGIYVKSITPGGPAAKEGRILQGDRLLQVDGVSLCGLTHKQAVQ
CLKGPGQVARLVLERRSPGLAQQCPSANDGMGERSAVSLVTALPGGPASCVSVTDGPKFE
VRLRKNTNGLGFSFVQVERGSCSLLRSDLIRIKRLFPGQPAEEHGAIAAGDIILAVNGRP
TEGLVFQEVLNLLRGPPQDITLLLCRPPPGVLPEMEPGWQTPMDKEFTRATCTDSEQSPS
LDQEDSWRDSTSPEAGEDLALGEAQGSRDTDRPRARSLALPLESHPHLCQRHRETEVPSP
ASPLEQDMRQNCYSVCDIRRLGRLSLSSSLTRLATDIF
Download sequence
Identical sequences ENSCPOP00000002104 10141.ENSCPOP00000002104 ENSCPOP00000002104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]