SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002220 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002220
Domain Number 1 Region: 11-136
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.83e-30
Family Hormone receptor domain 0.0024
Further Details:      
 
Domain Number 2 Region: 128-404
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000659
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002220   Gene: ENSCPOG00000002438   Transcript: ENSCPOT00000002471
Sequence length 406
Comment pep:known scaffold:cavPor3:scaffold_80:6072499:6079686:1 gene:ENSCPOG00000002438 transcript:ENSCPOT00000002471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLRVLLLLLSLRRVQTDSGPQTAGELYQRWERYQRECQEALGAAEPPSGLACNGSFDMYV
CWDYAAPNTTARASCPWYLPWHQHVAAGFVLRQCGSDGQWGPWRDHTQCEDPEKNEALQD
QRRILERLQVVYTIGYSLSLATLLLALLILSFFRRLRCTRNYIHINLFTSFILRAAAILT
RDRLLPPPRPYPGDQTRTLWNKALATCRTAQIVTQYCVGANYTWLLVEGVYLHRLLVLVG
GSEEGHLHGYLLLGWGAPALFVIPWVIVRYLYENTQCWERNDVKAFWWIIRTPILMTILI
NFLIFMRILGILLSKLRTRQMRCPDYRLRLARSTLTLVPLLGVHEVVFAPVIEEQAEGTL
RFAKLGFEIFLSSFQGFLVSVLYCFTNKEVQTEIRRGWHHCSLRHS
Download sequence
Identical sequences 10141.ENSCPOP00000002220 ENSCPOP00000002220 ENSCPOP00000002220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]