SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002515 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002515
Domain Number 1 Region: 251-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-16
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 93-154
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000484
Family KRAB domain (Kruppel-associated box) 0.0032
Further Details:      
 
Domain Number 3 Region: 359-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000707
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 289-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000056
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002515   Gene: ENSCPOG00000002770   Transcript: ENSCPOT00000002805
Sequence length 427
Comment pep:known scaffold:cavPor3:scaffold_9:51424530:51428789:1 gene:ENSCPOG00000002770 transcript:ENSCPOT00000002805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMLSKQTTSLGTGWESMNIQLDGTEPQVERGSQEEGPWRAAPGPGPLEHLCCGLEEEPQS
LQKAAQSAPWVPAIPQEGSTGDWEMAAALLAAGSQGLVTIKDVSLSFSQEEWRSLDPSQT
DFYGEYVMQENCGIVVSLRFPIPKLDMLPQPEGGEEQWVPNPQDLEERDILRITYTGDGS
EQEGDTPDLEAEPPRILSSVSEDTVLWNPEQDENWDSTPRSSRGMPLGPPFLQEDSFSNL
LSSTEMDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKSFGRRHHLIRHQ
KTHLHDKPSRCSECGKNFRCNSHLASHQRVHTEGKSCKVQGMEENAGARKQQHALPVPKC
HVCTECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQNLRSSW
DRGTSVF
Download sequence
Identical sequences 10141.ENSCPOP00000002515 ENSCPOP00000002515 ENSCPOP00000002515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]