SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002855 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000002855
Domain Number - Region: 802-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 211-350
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0314
Family Growth factor receptor domain 0.0033
Further Details:      
 
Domain Number - Region: 542-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family Laminin-type module 0.038
Further Details:      
 
Domain Number - Region: 409-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0514
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 368-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0628
Family Laminin-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002855   Gene: ENSCPOG00000003151   Transcript: ENSCPOT00000003194
Sequence length 1139
Comment pep:known scaffold:cavPor3:scaffold_6:16425983:16534931:-1 gene:ENSCPOG00000003151 transcript:ENSCPOT00000003194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVISLNSYLGFIGLLLFHWTGTASALNLEDPNVCSHWESYSVTVQESYPHPFDQVYYTSC
TDILNWFKCTRHRISYRTAYRHGEKTMYRRKSQCCPGFYESRDMCVPHCADKCVHGRCIA
PNTCQCEPGWGGTNCSSACDGDHWGPHCSSRCQCKNEALCNPITGACHCAAGFRGWRCED
RCEQGSYGNDCHQRCQCQNGATCDHVTGECRCPPGYTGAFCEDLCPPGKHGPQCEQRCPC
QNGGVCHHVTGECSCPPGWMGTVCGQPCPEGRFGKNCSQECQCHNGGTCDATTGQCHCSP
GYTGERCQDECPVGTYGVRCAQTCRCVNGGKCYHVSGTCLCEAGFGGELCEARLCPEGLY
GIKCDKRCPCHLDNTQSCHPMSGECACNAGWSGLYCNETCSPGFYGEACQQICSCQNGAD
CDSVTGKCTCAPGFKGIDCSTPCLPGTYGINCSSHCGCKNGAVCSPVDGSCTCKAGWHGV
DCSISCPSGTWGFGCNLTCQCLHGGACNTLDGTCTCAPGWRGQKCEFPCQDGTYGLNCAE
RCDCSHADGCHPTTGHCRCLPGWSGVHCDSVCAEGRWGPNCSLPCYCKNGASCSPDDGIC
ECAPGFRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVC
PSGRFGKNCAGICTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPPAHWGPNCIHTCNCHN
GAFCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCQNGADCDHISGQCTCRTGF
MGRHCQQKCPAGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGARCDQAGVIIVGNLN
SLSRTSTALPADSYQIGAIAGVIILILVILFLLALFIIYRHKQKGKESSMPAVTYTPAMR
VINADYTISETLPHSNGGNASSHYFTNPSYHTLAQCATSPHINNRDRMTIAKSKNNQLFV
NLKNMNSRKRGPAVDCTGTLPADWKHGGYLNELGAFGLERSYMGKSLKDLGKNSEYNSSN
CSLSSSENPYATIKDPPALLPKNSECGYVEMKSPARRDSPYAEINSSTSANKNVYEVEPT
VSVVQGIFSNAGHLTQDPYDLPKNSHIPCHYDLLPVRDSSSSPEQEHGGSGGGSSSSSS
Download sequence
Identical sequences 10141.ENSCPOP00000002855 ENSCPOP00000002855 ENSCPOP00000002855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]