SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004065 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004065
Domain Number 1 Region: 1142-1337
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.44e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 933-1056
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-31
Family Pleckstrin-homology domain (PH domain) 0.000000574
Further Details:      
 
Domain Number 3 Region: 39-162
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-20
Family PDZ domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004065   Gene: ENSCPOG00000004505   Transcript: ENSCPOT00000004554
Sequence length 1474
Comment pep:known scaffold:cavPor3:scaffold_109:1961890:2092136:1 gene:ENSCPOG00000004505 transcript:ENSCPOT00000004554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATRQTGLPDGDGGDKLKASAVSKNKDGKEQSETVSPSEEETFSWPGPKTVMLKRTSQG
FGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLC
TGDRIIKVNGESVIGKTYSQVIALIQNSGTTLELSVMPKDEDILQVLQFTKDVTALAYSQ
DAYLKGNEAYSGNAQNIPEPPPVCYPWLPPTPSAMAQPAEVSPPESSLNKQQTTTPVLTQ
PGRAYRVEIQVPPSPTDVAKSNTAVCVCNESIRTVIVPSEKVVDLLPNRNNHAGPSHRTE
EVRYSINEQTSLKTVSRTISPSSFPTAHLIHQTAGSRSLEPSGILLKSGNYSGHAEGISS
SRSQAVDSPVSVNHYSPNSHQHIDWKNYKTYKEYIDDRRLHIGCRTIQERLDSLRAASQN
TTEYNQVVPTRTALQVRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGAL
TSPPVSFSNHRTRSWDYMEGQGETVENVNSENKIPDSNGERKQTYKWSGFTEQDDRRGIY
ERSRQQEIHKSFRGSNLTVAPSVVNADNRRVSSRGVGSVSQFKKIPPDLKPLPSNRTFPT
AGGMPLPRGISQDRSPLVKARSNSLKAPSTHVAKPSFSQNSLVSVKDQRPVNHLHQNSVL
NQQSWFRTESALDHQRETGKSAPSSGASTKPGPQTSENVGATDLELSASQRSQDVNLQEA
DTQQSNTSDNKETVILREKPPSGRQTPQPLRHQSYILAMSDQETGSDTTCWLPNDARREV
HIKRMEERKASSASPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASTSQVPSIATV
PPSLTTSAPLIRRQLSHDQESLGPPSLDAQPSSKTERSKSYDEGLDDYREDAKLSFKHVS
SLKGIKIMDSQKSSEDSGSRKGSSLEVFSDAAKEGWLQFRPLVAEKGKRVGGSIRPWKQM
YVVLRGHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQ
AEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEQLPKTPRQSLSI
RQTLRGKSEVKTQSPHSPKEESERKLLSKDDTSPPKDKGTWRKGIPSIMRKTFEKKPAAT
GTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKG
MADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKRL
IHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMP
DQYKIVETLIQHHDWFFTEEGAEEPLTAVQEENTVDSQPVPNIDHLLTNIGRTGASPGDV
SDSATSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDSVFF
KKESVEQCHSDTKEESKKESETLVRNQRILIAKE
Download sequence
Identical sequences 10141.ENSCPOP00000004065 ENSCPOP00000004065 ENSCPOP00000004065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]