SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004166 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004166
Domain Number 1 Region: 433-679
Classification Level Classification E-value
Superfamily vWA-like 8.89e-68
Family Trunk domain of Sec23/24 0.00014
Further Details:      
 
Domain Number 2 Region: 681-776
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 6.15e-35
Family beta-sandwich domain of Sec23/24 0.0017
Further Details:      
 
Domain Number 3 Region: 230-450
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.15e-32
Family beta-sandwich domain of Sec23/24 0.0042
Further Details:      
 
Domain Number 4 Region: 885-1026
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 3.4e-30
Family C-terminal, gelsolin-like domain of Sec23/24 0.0014
Further Details:      
 
Domain Number 5 Region: 778-884
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 4.18e-25
Family Helical domain of Sec23/24 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004166   Gene: ENSCPOG00000004621   Transcript: ENSCPOT00000004670
Sequence length 1030
Comment pep:novel scaffold:cavPor3:scaffold_7:734259:825556:-1 gene:ENSCPOG00000004621 transcript:ENSCPOT00000004670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVATPPYSQSQPGIGLSPPHYGHYGDASHAASLPGMMKPVGNLGAAAPGVMVPPG
PPLPGPHQLGPNAAHASGPSPQRFPGPPPVVSAAPTYAQYQPSTQSTYASPVSTSSVTHL
GSQLSQLQVNSYGKCQKTEKRRGESRRLIASVEMLYIPRAIGISIVITTESFILMNDISM
LIKLGIEAAGLLSCTGSGVLGSESYIWDLGKSGLFKFFFPSSQLWPADGYAQLSYPGGFP
GDAQMAGPLPPQKKSDLDSSPSSIEVIENDRAIREGQVYATNTRGQVPPLVTTDCVIQDQ
GNASPRYIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNETPLYLVNHGESGPVRCN
RCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSLGSYEF
VATLDYCRKNKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTVLEKLPKEEQEETSAIR
VGFITYNKVLHFFNVKSNLAQPQMMVVTDVAEVFVPLLDGFLVNYQESQSVIHNLLDQIP
EMFADSNENETVFVPIIQAGMEALKAAECPGKLYIFHSSLPTAEAPGKLKNRDDKKLVNT
DKEKILFQPQTNIYDSLAKDCVAHGCSVTVFLFPSQYVDVASLGLVPQLTGGTLYKYNHF
QMHLDSQQFLSDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGVCMNNTTDVEMAAIDCD
KAVTVEFKHDDRLSEDSGALIQCAVLYTTVGGQRRLRIHNLGLSCSSQLADLYKSCETDA
LINFFAKSDTAFKAVLHQPLKVIREILVNQTAHMLACYRKYCVTSTIARQLILPDSMKVL
PLYMNCLLKNCVLLSRPEISIDERAYQRQLVMTMGVADSQLFFYPQLLPVHTLDVKSAAL
PAAVRCSESRLSEEGIFLLTNGLNTFLWLGVGSPPEAIQGIFNVPSFAHVNTDMTLLPEV
GNPYSQQLRMIMNVIQEKWPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYMDFLRC
VHKEISQLLN
Download sequence
Identical sequences 10141.ENSCPOP00000004166 ENSCPOP00000004166 ENSCPOP00000004166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]