SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004985 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004985
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.35e-26
Family Hormone receptor domain 0.000071
Further Details:      
 
Domain Number 2 Region: 59-355
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000705
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004985   Gene: ENSCPOG00000005535   Transcript: ENSCPOT00000005594
Sequence length 384
Comment pep:known scaffold:cavPor3:scaffold_65:2570278:2586137:1 gene:ENSCPOG00000005535 transcript:ENSCPOT00000005594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSPAVSTPGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANG
SWAARVNYSECQEILNEEKKSKVHYQIAVIINYLGHCISLVALLVAFILFLRLRSIRCLR
NIIHWNLISAFILRNATWFVVQRTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSLLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV
Download sequence
Identical sequences ENSCPOP00000004985 ENSCPOP00000004985 10141.ENSCPOP00000004985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]