SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005323 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005323
Domain Number 1 Region: 252-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 83-211
Classification Level Classification E-value
Superfamily SET domain 0.000000000000036
Family Histone lysine methyltransferases 0.028
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000005323
Domain Number - Region: 211-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00636
Family Classic zinc finger, C2H2 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005323   Gene: ENSCPOG00000005901   Transcript: ENSCPOT00000005964
Sequence length 368
Comment pep:novel scaffold:cavPor3:scaffold_27:2403813:2418558:-1 gene:ENSCPOG00000005901 transcript:ENSCPOT00000005964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLLEDKSHHASPK
TAFTAEVLAQSFSGEVQKLSSLVLPVEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGR
VIAPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQI
GTSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEDEQKKNKHEDFHPGDAAAGTA
GRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPYK
CQVCQSAYSQLGLRAHQKSARHRAAQRRAAAGIGGPALPSSRPPGQEASYESQSESHTSA
GHFPAWTM
Download sequence
Identical sequences ENSCPOP00000005323 ENSCPOP00000005323 10141.ENSCPOP00000005323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]