SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005526 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005526
Domain Number 1 Region: 369-553
Classification Level Classification E-value
Superfamily NTF2-like 1.72e-65
Family NTF2-like 0.0000000131
Further Details:      
 
Domain Number 2 Region: 108-199
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.1e-36
Family Non-canonical RBD domain 0.00000518
Further Details:      
 
Domain Number 3 Region: 203-358
Classification Level Classification E-value
Superfamily L domain-like 7.48e-33
Family mRNA export factor tap 0.000000156
Further Details:      
 
Domain Number 4 Region: 550-618
Classification Level Classification E-value
Superfamily UBA-like 7.65e-26
Family TAP-C domain-like 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005526   Gene: ENSCPOG00000006126   Transcript: ENSCPOT00000006190
Sequence length 618
Comment pep:known scaffold:cavPor3:scaffold_44:15013650:15023608:1 gene:ENSCPOG00000006126 transcript:ENSCPOT00000006190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEGKSYNEHDDRVSFPQRRKKGRGPFRWKYGDGNRRSGRGSSSVRSPRLEENDGDVAM
SETQDGPRVRYNPYSSRPNRRGDAWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFK
ITIPYGRKYEKSWLLSMIQSKCSVPFTPVEFHYENTRAQFFVEDASTASALKAVNYKIVD
RENRRISIIINSSAPPHTVQNELKPEQVEQLKLVMSKRYDGSQQALDLKGLRSDPDLVAQ
NIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYKLDDMSSIVQKAPNLKILNLSGN
ELKSERELDKIKGLKLEELWLDGNTLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIA
FDVEAPTVLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIP
FIPQNPARSNLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVV
DISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASP
EEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQTFSTQSGMNLEWSQKCLQDNNWDYTRSAQ
AFTHLKAKGEIPEVAFMK
Download sequence
Identical sequences H0V731
10141.ENSCPOP00000005526 ENSCPOP00000005526 XP_003467959.1.53824 ENSCPOP00000005526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]