SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005630 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005630
Domain Number 1 Region: 491-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 3.4e-70
Family A middle domain of Talin 1 0.0000003
Further Details:      
 
Domain Number 2 Region: 756-891
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.53e-52
Family I/LWEQ domain 0.00000214
Further Details:      
 
Domain Number 3 Region: 661-785
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.76e-51
Family I/LWEQ domain 0.00000478
Further Details:      
 
Domain Number 4 Region: 2296-2481
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.57e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 5 Region: 1840-1974
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.73e-47
Family VBS domain 0.00000721
Further Details:      
 
Domain Number 6 Region: 1227-1363
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.49e-41
Family VBS domain 0.028
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 8.37e-32
Family Second domain of FERM 0.0000013
Further Details:      
 
Domain Number 8 Region: 1076-1209
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.12e-29
Family VBS domain 0.012
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-24
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 10 Region: 1471-1557
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000144
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 11 Region: 2006-2133
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000377
Family VBS domain 0.015
Further Details:      
 
Domain Number 12 Region: 1698-1816
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000173
Family VBS domain 0.063
Further Details:      
 
Domain Number 13 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000737
Family Ubiquitin-related 0.062
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000005630
Domain Number - Region: 946-1044
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000161
Family I/LWEQ domain 0.0029
Further Details:      
 
Domain Number - Region: 1586-1661
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000345
Family VBS domain 0.041
Further Details:      
 
Domain Number - Region: 2108-2229
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0392
Family I/LWEQ domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005630   Gene: ENSCPOG00000006242   Transcript: ENSCPOT00000006307
Sequence length 2542
Comment pep:known scaffold:cavPor3:scaffold_98:704962:872891:1 gene:ENSCPOG00000006242 transcript:ENSCPOT00000006307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGVTKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATADAELLKQVSAAASVVSQA
LHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPDNEDQQHRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKA
VADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAM
QLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAGESQLKP
LPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGV
AASTSDPTAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAESQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVH
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLD
NPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPGFGECVGIASKALCGLTE
AAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIV
AKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKC
RIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTAR
SLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQA
SLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYF
EPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEA
AQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK
YSKAIAVTAQEMMTKSVTNPEELGGLASQMTTDYGHLAVQGQMAAATAEPEEIGFQIRTR
VQDLGHGCIFLVQKAGALQVCPSDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACI
TAATAVSGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAAS
TPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLIGATK
GAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQELTV
FQSKEVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTAC
KQASFHPDVSDEVRTRALRYGTECTLGYLDLLEHVLVILQKPTPELKHQLAAFSKRVAGA
VTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARM
VAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAA
GNAVKRASDNLVRAAQKAAFGKMDDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARK
KLAQIRQQQYKFLPTELREDEG
Download sequence
Identical sequences A0A286XDN7
XP_013001016.1.53824 XP_013001017.1.53824 XP_013001018.1.53824 XP_013001019.1.53824 10141.ENSCPOP00000005630 ENSCPOP00000005630 ENSCPOP00000005630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]