SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005650 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005650
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.49e-45
Family Galectin (animal S-lectin) 0.000000627
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005650   Gene: ENSCPOG00000006267   Transcript: ENSCPOT00000006332
Sequence length 135
Comment pep:known scaffold:cavPor3:scaffold_28:22129283:22130940:1 gene:ENSCPOG00000006267 transcript:ENSCPOT00000006332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAQGLVASNLNLKPGECLRVRGEVAPEAKSFVLNLGKDSNNLCLHFNPRFSAHGDTNTIV
CNSKDGGAWGTEHREPAFPFQPGSVVEVCISFDKTDLTITLPDGHQFKFPNRLNLEAINY
LAADGDFKIKCMAFE
Download sequence
Identical sequences ENSCPOP00000005650 10141.ENSCPOP00000005650 ENSCPOP00000005650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]