SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006122 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006122
Domain Number 1 Region: 229-374
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.49e-31
Family AlaX-like 0.038
Further Details:      
 
Domain Number 2 Region: 4-111
Classification Level Classification E-value
Superfamily HSP20-like chaperones 7.33e-27
Family Co-chaperone p23-like 0.0000824
Further Details:      
 
Domain Number 3 Region: 168-223
Classification Level Classification E-value
Superfamily Translation proteins 0.0000304
Family AlaX-M N-terminal domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006122   Gene: ENSCPOG00000006792   Transcript: ENSCPOT00000006861
Sequence length 543
Comment pep:known scaffold:cavPor3:scaffold_53:12730470:12742124:-1 gene:ENSCPOG00000006792 transcript:ENSCPOT00000006861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCRQHARTLWYDRPKYVFMEFCVEDSTDVRVLLEDHRVVFSCRNGDGVELYNEIEFYAKV
NSKDSQDKRSGRSVTCFVRKWKEKVAWPRLTKEDIKPVWLSVDYDNWRDWEGDEEMELAQ
VEHYAELLQKVSTKGPPPAMDDLDFSTVVVACCPTELPALAGEDPKAARRGFRVVLEDTL
LFPGSNGVPDDRGTIDDVPVLRVTRRGAEADHFTEMPLAPGSQVCVRVDWERRFDHMQQH
SGQHLITAVAEQLFGLKTTSWELGRLRSAIELDSPSVTAEQVAAIEQSVNEKIRARLMVS
VRELSPDNPEVEQVRGRGLPDDHAGPVRVVTIEGVDASMCCGTHVSNLSDLQIIKILGTE
KGKKNKTNLLFLAGQRVLKWVERSHESEKALTSLLKCGAEDHVQVVTKLQSSVKLLQKNN
LNLLRDLAVHVARSLRADPDWGGVVALHRKDGDSEFMNIIANEVGAEDTLLFLTVGDEKG
AGLFLLAGPPETVETLGPRVAEVLEGKGAGKKGRYQGKAAKMGRRMEAQALLQKHARLRG
LEG
Download sequence
Identical sequences ENSCPOP00000006122 ENSCPOP00000006122 10141.ENSCPOP00000006122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]