SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006287 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006287
Domain Number 1 Region: 1006-1104
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-26
Family PDZ domain 0.00026
Further Details:      
 
Domain Number 2 Region: 392-500
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-24
Family PDZ domain 0.0000478
Further Details:      
 
Domain Number 3 Region: 839-937
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-23
Family PDZ domain 0.00012
Further Details:      
 
Domain Number 4 Region: 698-810
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-22
Family PDZ domain 0.00043
Further Details:      
 
Domain Number 5 Region: 123-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-16
Family Nucleotide and nucleoside kinases 0.0033
Further Details:      
 
Domain Number 6 Region: 552-661
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-16
Family PDZ domain 0.00021
Further Details:      
 
Domain Number 7 Region: 287-327
Classification Level Classification E-value
Superfamily WW domain 0.000000000000223
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 337-371
Classification Level Classification E-value
Superfamily WW domain 0.00000000127
Family WW domain 0.0029
Further Details:      
 
Domain Number 9 Region: 16-111
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000145
Family PDZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006287   Gene: ENSCPOG00000006971   Transcript: ENSCPOT00000007040
Sequence length 1471
Comment pep:known scaffold:cavPor3:scaffold_2:37759608:38021989:1 gene:ENSCPOG00000006971 transcript:ENSCPOT00000007040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTLKKKKHWLSKVQECVVSWSGPPGDLGAEIRGGAERGEFPYLGRLREEPGAGTCCVV
SGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQ
FQKGSIDHKLQQVIRDNLYLRTIPCTTRAPREGEVPGVDYNFISVEQFKALEESGALLES
GTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEE
EDEDKEAINGSGNTENRERHSESSDWMKTVPSYNQTNSSMDFRNYMMRNENLEPLPKNWE
MAYTDTGMIYFIDHNTKTTTWLDPRLCKRAKAPEDCEDGELPYGWEKIEDPQYGTYYVDH
LNQKTQFENPVEEAKRKKQLGQAEIGSSKSDMEKSHFTRDPSQLKGVLVRASLKKSTMGF
GFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLV
PVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMTTQDCKPGALLLEQ
NGKSGHTLMSDHLNGPSDPNEQRASMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQK
VKMILDSQWCPGLQKGDIIKEVYHQNVQSLTHLQVVEVLKQFPVGADVPLLILRGGPPSP
TKTGKMKTDKKENSGSLETINEPIPQPMPFPPSIMRSGSPKLDPSEVYLKSKTLYEDKPP
NTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIP
VKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDDSSQAFISTQNGSPCLNRAEV
PTRPASQEAYDVVLQRKETEGFGFVILTSKSKPPPGVIPHKIGRVIEGSPADRCGKLKVG
DHISAVNGQSIIELSHDSIVQLIKDAGVTVTLTVVAEEEHHGPPSGTNSARQSPALQHRP
MGQAQANHIPGDRTALEGEMGKDTSSSYRHSWSDHKHLPQPDTAVSSVVGSRHHQSLGCY
PVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPALKDGRIHVGDQIVEINGEPTQGIT
HTRAIELIQAGGNRVLLLLRPGTGLIPDHGDWDINNPSSSNVIYDEQSPFPPSSHSASIF
EESHVPGIEDSLMRVQICEKAEELKDTVPEKKSTLNETQSEIKHQSFLQKNVNKRDPPSS
HGHSDKKSLQRLDSGVTQRGGSVSPKKSAHHYSEEHLEKLPCPPKYDPKRRPRDRSLSPR
KRYQTDPRAASGQDHYKKSRGRSSSPRKQQKTEECKDLSNAEDTLPKGEGHRGAGRATDS
AEQVPDWKENSSLISKDVKQSQLGKDKTRSAEKQSKRMDEKSLASKKRIVSGNEKGKKPT
VGEIHSAKDKIGENVQISEKKVRQEPEEKTLLNKTEDHKEKELKTADKCKESGRVKPESS
SPVKKAPITPGPWKVPSANKVTGTTGMAEKR
Download sequence
Identical sequences ENSCPOP00000006287 10141.ENSCPOP00000006287 ENSCPOP00000006287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]