SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007694 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007694
Domain Number 1 Region: 4-554
Classification Level Classification E-value
Superfamily SIS domain 1.53e-232
Family Phosphoglucose isomerase, PGI 0.00000000000000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007694   Gene: ENSCPOG00000008562   Transcript: ENSCPOT00000008639
Sequence length 558
Comment pep:known scaffold:cavPor3:scaffold_52:8814777:8838768:-1 gene:ENSCPOG00000008562 transcript:ENSCPOT00000008639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTRNPEFQKLQQWHREHGSDLNLRRLFEADKERFNHFSLTLNTNHGHILLDYSKNLV
TEDVMKMLVELAKSRGVEAARERMFSGEKINYTEDRAVLHVALRNRSNTPMLVDGKDVMP
EINKVLDKMKSFCQRVRNGDWKGYTGKAITDVINIGIGGSDLGPLMVTEALKPYSSGGPH
VWFVSNIDGTHIAKTLANLNPETSLFIIASKTFTTQETITNAETAKEWFLMSAKDASAVA
KHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTAPLEKNAPVLLALLGIWYINCFGCETQALLPYDQYLHRFPAYFQQGDMESN
GKYITKPGVRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMKGKSTEEARKELQAAGKSPGDLEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIALYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAAVTSHDS
STNGLINFIKQQREARTE
Download sequence
Identical sequences H0VCM3
10141.ENSCPOP00000007694 XP_003467245.1.53824 ENSCPOP00000007694 ENSCPOP00000007694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]