SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007819 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007819
Domain Number 1 Region: 143-479
Classification Level Classification E-value
Superfamily Subtilisin-like 3.53e-88
Family Subtilases 0.0000000252
Further Details:      
 
Domain Number 2 Region: 474-619
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.72e-34
Family Proprotein convertase P-domain 0.00084
Further Details:      
 
Domain Number 3 Region: 53-133
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000272
Family Prohormone convertase 1 pro-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007819   Gene: ENSCPOG00000008710   Transcript: ENSCPOT00000008788
Sequence length 788
Comment pep:known scaffold:cavPor3:scaffold_19:30728068:30746317:1 gene:ENSCPOG00000008710 transcript:ENSCPOT00000008788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKGRQKVPHLDALLGLPTCLWLELAGFFLLAPWVMGLAGAAGPDAHGTVGLSWAVHLDS
PGGDQEEEHLEQQAEAVARAAGLVNAGRIGELQGHYLFVHPTGPSQALEVQVIRQQAEAV
LAGHKAVRWHSEQRLLKRAKRSIHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRG
VTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVESGNHHGTRCAGEIAAAP
NNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGP
HQLGKAALQHGVMAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRM
PFYAEECASMLAVTFSGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALML
QVRPCLTWRDVQHIIVFTATQYEDRHADWLTNEVGFSHSHQHGFGLLNAWRLVNAAKVWT
SVPYLASYFSPVLKENKAIPRSPRSLEVLWNVSRADLETSGLKTLEHVAVTVSISHPRRG
SLELKLFCPSGMMSLIGAPRSMDSDPSGFNDWSFSTVRCWGERAKGTYRLVIRDVGDEPP
QLGILQHWQLTLYGSMWSPADIRERQRLLESAMSGKYLHDGFTLPCPPGLKIPEEEGYTI
TPNTLKTLVLVGCFTVFWTIYYMLEVYMSHRTVASTQGCRNGPCHWPQRSRKSREEGTEL
ESVPLCNSKDLSGAEAESGGPPTTSDLLGPDLLCEGDWTLSQNNQAALDGPYQHRPPDLL
QGQEEQIC
Download sequence
Identical sequences H0VCY6
10141.ENSCPOP00000007819 ENSCPOP00000007819 ENSCPOP00000007819 XP_013010968.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]