SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008176 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008176
Domain Number 1 Region: 335-431
Classification Level Classification E-value
Superfamily Immunoglobulin 3.62e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 453-785
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 2.88e-16
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 81-133
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000236
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 257-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000519
Family I set domains 0.036
Further Details:      
 
Domain Number 5 Region: 180-252
Classification Level Classification E-value
Superfamily EF-hand 0.000000000584
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008176   Gene: ENSCPOG00000009103   Transcript: ENSCPOT00000009186
Sequence length 845
Comment pep:known scaffold:cavPor3:scaffold_7:42362962:42901957:-1 gene:ENSCPOG00000009103 transcript:ENSCPOT00000009186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPSWSAILVLGFILLDSEGRPMKEAVHGLKFYQPLTRLRHKQEKSQESSRFKGFLIPDD
PFGSCENKYCGLGRHCVISKETRQAECACMDVCRQHYKPVCGSDGEFYANHCEVHRAACL
KRQKITIVHDEDCFFKGDNCKTNVYNKMKSMLLDLQKQKYITQDNENPNGDDVSRKKLLV
DQMFKYFDADSNGLVDINELTQVIKQEDLSKDHSECTLYDLLKFDDLNADKHLALDEFYR
AFQVIQLSLPEDQRLRITAATVGQSVVLSCAVHGDLRPPIIWKRNNIVLNDLDLEDINDF
GDDGSLYITKVTTTHMGNYTCYADGYAHVYQTHIFQVNVPPVIRVYPESQAREPGVTASL
RCHAEGVPDPQLGWLKNGVDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCVAKNEAG
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSE
KLLGFQDEVCPRAQGEADQRCVWASAVNVKDKFIYAAQPTLSRVLVVDVQSQKVVQAVST
DPVPVKLHYDKSHDQVWVLSWGSMEKTSPTLQVVTLASGNGPHHTVHTQPVGRQFDRVDD
FFIPSPTLLISHVRFGFILHKDEAALHKIDLETLSYVRSVDLGAHGCVPHSLAYSHLGGY
YFVSCRPDGSGATLPQLVVDGVTDAVIGPNDNVTGVPYVSPDGHYLVSVDNTRGLVHVQH
IGARGEIRGAFDVRTDLHLADLAFLPSFTAARGYTACGSAGTQALCLDLASGAVSVLGGL
KEPLPAAQWPWDAKNRRVQASGLFGQYLMTPSEDSLFILDGRLNRLNCEITQVAKGNTLV
WVGEA
Download sequence
Identical sequences H0VDV2
ENSCPOP00000008176 XP_003477041.1.53824 10141.ENSCPOP00000008176 ENSCPOP00000008176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]