SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009030 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009030
Domain Number 1 Region: 180-249
Classification Level Classification E-value
Superfamily Homeodomain-like 7.27e-18
Family Homeodomain 0.0000547
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.24e-16
Family LIM domain 0.021
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000136
Family LIM domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009030
Domain Number - Region: 117-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00185
Family LIM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009030   Gene: ENSCPOG00000010057   Transcript: ENSCPOT00000010148
Sequence length 359
Comment pep:known scaffold:cavPor3:scaffold_98:2683537:2686902:1 gene:ENSCPOG00000010057 transcript:ENSCPOT00000010148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDLLLQCPFPGAMGDPSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYARLFGIKCAKCQVGFSSSDLVMRARDSVFHVECFRCAVC
SRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPIPGARALHLPEPVPGQQPAL
RPHVHKQAEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQ
NKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHDSAVQGSAVEVQTFQPP
WKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVRR
Download sequence
Identical sequences ENSCPOP00000009030 ENSCPOP00000009030 10141.ENSCPOP00000009030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]