SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009505 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009505
Domain Number 1 Region: 223-424
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-50
Family DBL homology domain (DH-domain) 0.00000000578
Further Details:      
 
Domain Number 2 Region: 416-540
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-35
Family Pleckstrin-homology domain (PH domain) 0.0000134
Further Details:      
 
Domain Number 3 Region: 148-217
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-25
Family SH3-domain 0.0000412
Further Details:      
 
Domain Number 4 Region: 17-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.84e-20
Family Calponin-homology domain, CH-domain 0.00064
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009505
Domain Number - Region: 781-837
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.00745
Family Oxygen-evolving enhancer protein 3, 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009505   Gene: ENSCPOG00000010585   Transcript: ENSCPOT00000010680
Sequence length 845
Comment pep:novel scaffold:cavPor3:scaffold_5:15506934:15608386:-1 gene:ENSCPOG00000010585 transcript:ENSCPOT00000010680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPKKTIADPERLCRAGVLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRAC
GASLRLETFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLG
AQSSHSRTSKLFQSQYRSLDMTENSNNQLVVKAKFNFQQTNEDELSFSKGDVIHVTRVEE
GGWWEGTHNGRTGWFPSNYVREIKPSEKPVSPKSGALKSPPKGFDTTAINKSYYNVVLQN
ILETENEYSKELQTLLSTYLRPLQTTEKLSSANTSYLMANLEEICSFQQMLVQSLEECTK
SPEAQQRVGGCFLNLMPQMRTLYLAYCANHPSAVSVLTEHSEELGEFMETKGASSPGILV
LTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRQDIQKSMTAFKTLSVQCQEVRKRKELE
LQILTESIRSWEGDDIKTLGNVTYMSQVMIQCAGSEEKSERYLLLFPNLLLMLSASPRMS
GFIYQGKLPTTGMMITKLEDSENHRNAFEISGSMIERILVSCNNQQDLHEWVDHLQKQTK
VTSVSNPTIKPHSIPSHTLPSHPITPSSKHADSKPVALMPAYHTLPHPSHHGTPHTTISW
GPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEF
ALRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQSSLDSLGR
RSSLSRLEPSDPSEDSEYDSIWTAHSYRMGSASRSRKECAPQVLLPEEEKIIVEETKSNG
QTVIEEKSLVDTVYALRDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAW
DETNL
Download sequence
Identical sequences ENSCPOP00000009505 10141.ENSCPOP00000009505 ENSCPOP00000009505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]