SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010225 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010225
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.83e-111
Family Choline/Carnitine O-acyltransferase 0.0000000000216
Further Details:      
 
Domain Number 2 Region: 359-577
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.06e-74
Family Choline/Carnitine O-acyltransferase 0.00000000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010225   Gene: ENSCPOG00000011375   Transcript: ENSCPOT00000011481
Sequence length 581
Comment pep:known scaffold:cavPor3:scaffold_31:25180311:25206457:1 gene:ENSCPOG00000011375 transcript:ENSCPOT00000011481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFFTVKPFANEEEYKKTEEIVKKFKNGIGGKLHQKLLERAKGKRNWLEEWWLNVAYLDVR
VPSQLNVNFAGPSAHFEHYWPPKEGVQLERGSIILWHNLNYWQRLRQEKMPVHKVGSTPL
DMNQFRMLFSTCKVPGVNRDYIMNYFKTESEGQSPSHIAVLCRGRVFVFEALHEGCLLTP
PELLRHLSYIHEKCHQEPPGFGVAALTTEERTQWAKARAYLIGLDPENLASLERIQSSLF
VYSLEDNSALVTPEDYSQILTMVLTGDPTVRWGDKSYNLISFSNGVFGCNCDHAPFDAMV
MVNIAHYVDERIIETEGRWMGSEKVRDIPLPEELLFTVDEKILNDIKQAKAQFLQEASDL
QIVAPAFTSFGKKLTKKHSLHPDTFIQLALQLAYYRLHGRPGCCYETAMTRYFYHGRTET
VRSCTMEAVRWCQAMQDPSASLFEQQQKMLQAFAKHNKMMKECSAGKGFDRHLLGLSLIA
KEEGLPVPELFTDPLFSRRPCSGGGGNFVLSTSLVGYLRIQGVVVPMVHNGYGFFYHIRD
DRFIVACSAWKSCLETDAKKLVEQIFVAFHDMMQLMNTARL
Download sequence
Identical sequences ENSCPOP00000010225 10141.ENSCPOP00000010225 ENSCPOP00000010225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]