SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010247 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010247
Domain Number 1 Region: 16-137
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.49e-23
Family Hormone receptor domain 0.00042
Further Details:      
 
Domain Number 2 Region: 128-392
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000174
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010247   Gene: ENSCPOG00000011400   Transcript: ENSCPOT00000011506
Sequence length 422
Comment pep:known scaffold:cavPor3:scaffold_44:7232161:7244959:1 gene:ENSCPOG00000011400 transcript:ENSCPOT00000011506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSWMWGACVLCLLSPLGAVSSQLGSSCLSLGSRSESQSLLAGVSRHLPSLCLGCPRTWD
GLLCWPMAATGDWVTLPCPDFFSYFSSEPGTVKRDCTITGWSDPFPPYPVACPVPLELLT
KEISYFSTMKIIYTMGHSISIVALFVAIAILVALRRLHCPRNYIHTQLFATFILKAGAVF
LKDATLFQDDTEHCVFSTVLCKVSVAASHLATMTNFSWLLAEAVYLSCLLASTSPNSRTA
FWWLVLAGWGLPMLCTGTWVGCKLAYEDIACWDLYDSSPYWWIIKGPIVLSVGVNFGLFL
NIIRILLRKLEPAQGSLYTHSQYWRLSKATLLLIPLFGIHYIVFNFLPDDAGLGIRLPLE
LGLGSFQGFIVAILYCFLNQEVRTEISRKWHGHDPELLPARQTCTKWTVPSHGGAKVLTS
RC
Download sequence
Identical sequences ENSCPOP00000010247 ENSCPOP00000010247 10141.ENSCPOP00000010247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]