SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010393 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010393
Domain Number 1 Region: 281-411
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000447
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 406-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000035
Family EGF-type module 0.006
Further Details:      
 
Domain Number 3 Region: 482-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000036
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 250-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 445-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000198
Family EGF-type module 0.039
Further Details:      
 
Domain Number 6 Region: 5-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000089
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 219-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000839
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010393   Gene: ENSCPOG00000011551   Transcript: ENSCPOT00000011662
Sequence length 638
Comment pep:novel scaffold:cavPor3:scaffold_13:31069354:31260989:1 gene:ENSCPOG00000011551 transcript:ENSCPOT00000011662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLVSDPCASNPCHHGNDGDGDGYLCVCSEGYAGPNCEQPLPGIPAPGLTESMQLQSVPPT
QKPDVTLPRSQATETLPTWQPKTGQKVVEMKWDQVEVIPDTACGNASSNSSAGGRLVSFE
VPQNTSVKIRQDATASLILLWKVTAAGFQQCSLIDGRSVTPLQAPGGLVLLEEMLSLGQN
HFIGFVNDSVTKSIVALRLTLVVKASVCVPGDGHANDLECSGKGRCTTKPAEATFSCTCE
DQYIGTFCEEFDACHRKPCKNEASCVDANEKQEGNNFTCLCLPGYTGDLCQSKIDYCVLD
PCRNGATCISSLSGFTCQCPEGYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCSCSPG
FTGPTCADLVDFCALSPCAHGTCRSVGTSYKCLCDPGYHGLYCEEEYNECLSAPCLNAAT
CRDLVNGYECVCLADYKGVHCESYKDPCANVSCLNGGACDSESLNGTCVCAPGFTGEECD
IDINECDSNPCHHAGTCLDQPNGYACHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSL
YIIIGALCVAFVLMLIILIVGICRISRIEYQGSSRPAYEEFYNCRSIDSEFSSAIASIRH
FRFGKKSRPAMYDVTPIAYEDYSPDDKPLVTLIKTKDL
Download sequence
Identical sequences 10141.ENSCPOP00000010393 ENSCPOP00000010393 ENSCPOP00000010393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]