SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010900 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010900
Domain Number 1 Region: 12-336,452-497
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.12e-62
Family FAD-linked reductases, N-terminal domain 0.004
Further Details:      
 
Domain Number 2 Region: 316-439
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.3e-29
Family L-aminoacid/polyamine oxidase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010900   Gene: ENSCPOG00000012120   Transcript: ENSCPOT00000012236
Sequence length 511
Comment pep:known scaffold:cavPor3:scaffold_1:34718436:34728691:-1 gene:ENSCPOG00000012120 transcript:ENSCPOT00000012236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSGGGGCEFSSSPRVLVIGGGIAGLGAAQRLCHYSAAPHLSVLEATARAGGRIHSRRGF
GGVVEMGAHWIHGPSQGNPVFQLAAAFGLLGEKELSEENQRVETGGHLDLRSICCTSSGT
RVSLELVAEMASLFYGLIDQTREFLHVPETPVPSVGEYLKKEIGQQVAHWTEDAETKKLK
LAILNNFFNTECCISGTHSMDLVALAPFGEYTVLPGLDCTFSGGYQELTNHIMASLPKDV
IVFNKPVKTIHWNGSFQEAAFPGETFPVLAECDDGSRFPAHHVIITVPLGFLKEHQDTFF
EPPLPAEKVEAIRKIGFGTNNKVFLEFEEPFWESDCQFIQVVWEDTSPLQDTASGLQDTW
FKKLIGFLVLPSFKSVHVLCGFIAGLESEFMETLSDEEVLLSLTQVLRRVTGNPRLPAPK
SVLRSCWHSSPYTRGSYSYVAVGSTGDDIDLLAQPLPSDGTSPQLQVLFAGEATHRTFYS
TTHGALLSGWREADRLMGLWDLKMQQPRPRL
Download sequence
Identical sequences ENSCPOP00000010900 10141.ENSCPOP00000010900 ENSCPOP00000010900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]