SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012498 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012498
Domain Number 1 Region: 1-224
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.33e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.003
Further Details:      
 
Domain Number 2 Region: 315-488
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.8e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012498   Gene: ENSCPOG00000013868   Transcript: ENSCPOT00000014009
Sequence length 538
Comment pep:known scaffold:cavPor3:scaffold_2:44992969:45014958:-1 gene:ENSCPOG00000013868 transcript:ENSCPOT00000014009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKRIAVIGGGVSGLSSIKCCLEEGLEPVCFERSADIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNSHVLEYFRMYAKEFGLLKYIQFKTTVCNVKKRPDF
STSGQWEVVTEHEGKTKVDVFDAVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNP
EAFTGKRVVIIGIGNSGGDLAVEISHTAKQVFLSTRRGSWILNRVGKHGYPTDVLLSSRF
TYFLSKILGQSLSNAYVEKQMNERFDHEMFGLKPKHSHRAMSQHPTVNDDLPNRIIAGMV
KVKGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFPFLEDSVKVVKNKVSLYKKVFP
PNLERPTLAIIGLIQPLGAIMPISELQGRWAVQVFKGLKTLPSQSEMMAEITKAQEEIAK
RYVDSQRHTIQGDYIQTMEEIAEFVGVKPNLLSLAFTDPKLALKLFFGPCTPIHYRLQGP
GKWHGARKAILTTYDRIRKPLNTRETEKSNSMVSAFWLDSKIYGCTFITPKYSSIICD
Download sequence
Identical sequences ENSCPOP00000012498 ENSCPOP00000012498 10141.ENSCPOP00000012498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]