SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013318 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013318
Domain Number 1 Region: 75-421
Classification Level Classification E-value
Superfamily Sialidases 1.26e-83
Family Sialidases (neuraminidases) 0.0000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013318   Gene: ENSCPOG00000014780   Transcript: ENSCPOT00000014925
Sequence length 426
Comment pep:known scaffold:cavPor3:scaffold_15:41108935:41112308:1 gene:ENSCPOG00000014780 transcript:ENSCPOT00000014925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTGPRQSPPGGKVPELPGSARLAGGGVGMPCFCEGARFRALAAVFLLLLSLAGLQARAEN
DFSQVQPLVTLEQLLWVSGRQIGAVDTFRIPLITATPRGTLLAFAEARKMSASDEGAKFI
ALRRSTDQGSTWSSTAFILDDGEAPDGLNLGAVVSDSETGVVFLFYTLCAHKFHCQVAST
MLVWSKDDGVSWSAPRNLSMDIGTEMFAPGPGSGIQKKWEPRKGRLIVCGHGTLERDGVF
CLLSDDHGDTWRYGSGISGIPYGQPKLENDFNPDECQPYELPDGSVIINARNQNNYHCHC
RIILRSYDACDTLRPRDITFDRELVDPVVAAGALVTSSGIIFFSNPAHPEFRVNLTLRWS
FSNGTSWQKEKVQLWPGPSGYSSLTALEGSRAGENQAPQLYVLYEKGMSRYTESISMAKV
SIYGTL
Download sequence
Identical sequences ENSCPOP00000013318 10141.ENSCPOP00000013318 ENSCPOP00000013318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]