SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013682 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013682
Domain Number 1 Region: 20-181,211-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.22e-68
Family BAR domain 0.0005
Further Details:      
 
Domain Number 2 Region: 265-297,328-385
Classification Level Classification E-value
Superfamily SH3-domain 6.02e-18
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013682   Gene: ENSCPOG00000015176   Transcript: ENSCPOT00000015323
Sequence length 386
Comment pep:known scaffold:cavPor3:scaffold_2:49650858:49682781:-1 gene:ENSCPOG00000015176 transcript:ENSCPOT00000015323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEILLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRSSQLNSARLEGDNIMIWAEEVTKSEQELRITQSEFDRQAEITRLLLEGISST
HAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSGTPVPSALPNAV
GSSAMASPSGLGITPASNVTDLKESSGSRKARVLYDYDAANSTELSLLADEVITVFSVVG
MDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences H0VSR5
ENSCPOP00000013682 10141.ENSCPOP00000013682 ENSCPOP00000013682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]