SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013803 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013803
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Hormone receptor domain 7.32e-24
Family Hormone receptor domain 0.00035
Further Details:      
 
Domain Number 2 Region: 79-355
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000915
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013803   Gene: ENSCPOG00000015317   Transcript: ENSCPOT00000015466
Sequence length 387
Comment pep:known scaffold:cavPor3:scaffold_3:60482523:60517259:-1 gene:ENSCPOG00000015317 transcript:ENSCPOT00000015466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCAGLWDNMSCWPSSAPGQTVEVECPRFLRMLTRSRNGSLFRNCTQDGWSETFPRPDLAC
GVNVNDSSNEKRHAFLLKLKVMYTVGYSSSLVMLLVALSILCAFRRLHCTRNYIHMHLFM
SFILRALSNFIKDAVLFSSEDVTYCDAHRVGCKLVMIFFQYCIMANYAWLLVEGIYLHTL
LTVSFFSQRKCLQEFVALGWGSPAIFVMSWAITRHFLEDVGCWDINANASIWWVIRGPVI
LSILINFIFFINILRILMRKLRTQDTGNEINQYKRLAKSTLLLIPLFGVHYIVFAFSPED
AMEVQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWRQWHLQEFPLRLNSSLSNGTS
DPTHGIQASSKASSSEQSRGTCRASII
Download sequence
Identical sequences ENSCPOP00000013803 10141.ENSCPOP00000013803 ENSCPOP00000013803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]