SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013865 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013865
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-77
Family BAR domain 0.00000000195
Further Details:      
 
Domain Number 2 Region: 270-333
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-23
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013865   Gene: ENSCPOG00000015380   Transcript: ENSCPOT00000015530
Sequence length 338
Comment pep:known scaffold:cavPor3:scaffold_21:3225375:3273828:-1 gene:ENSCPOG00000015380 transcript:ENSCPOT00000015530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTM
SKIRGQEKGPGYPQAEALLAEAMLKFGRELGEECNFGPALGEVGEAMRELSEVKDSLDME
VKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESK
EIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRRE
YQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPAGAPMDQPCCRALYDFEPENEGELGFKEG
DIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH
Download sequence
Identical sequences ENSCPOP00000013865 10141.ENSCPOP00000013865 ENSCPOP00000013865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]