SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014167 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014167
Domain Number 1 Region: 153-461
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.03e-84
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000267
Further Details:      
 
Domain Number 2 Region: 3-72,100-144
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00000000162
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014167   Gene: ENSCPOG00000015713   Transcript: ENSCPOT00000015868
Sequence length 514
Comment pep:known scaffold:cavPor3:scaffold_2:33378284:33396719:1 gene:ENSCPOG00000015713 transcript:ENSCPOT00000015868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLDLDLFRVDKGGNPDLIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLC
SKTIGEKMKKKEPVGDDDSVPENVLNFDDLTADTLANLKVSQIKNVRLLIDEAILKCDAE
RLKLEAERFENLREIGNLLHPSVPISNDEDADNKVERIWGDCTVRKKYSHVDLVVMVDGF
EGEKGAIVAGSRGYFLKGVLVFLEQALIQFALRTLASRNYVPIYTPFFMRKEVMQEVAQL
SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMIATAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKV
EFVHMLNATMCATTRTICAILENYQTEKGIIVPEKLREFMPPGLQELIPFVKPAPIDQEP
SKKQKKQHEGSKKKAATRDVTLENRLQNMEVTDA
Download sequence
Identical sequences A0A286XG63
ENSCPOP00000014167 10141.ENSCPOP00000014167 XP_003479247.1.53824 ENSCPOP00000014167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]