SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014441 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014441
Domain Number 1 Region: 31-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.62e-16
Family LIM domain 0.0099
Further Details:      
 
Domain Number 2 Region: 175-239
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000115
Family Homeodomain 0.0035
Further Details:      
 
Domain Number 3 Region: 3-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000328
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014441
Domain Number - Region: 92-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0105
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014441   Gene: ENSCPOG00000023977   Transcript: ENSCPOT00000020090
Sequence length 400
Comment pep:known scaffold:cavPor3:scaffold_203:212781:220114:-1 gene:ENSCPOG00000023977 transcript:ENSCPOT00000020090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRF
GTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYL
SSSSLKEGSLNSVSSCTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKR
RGPTTIKAKQLETLKAAFAATPSPRAIPRGGAQENEPLRVIQVWFQNRRSKERRMKQLSA
LGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGGNYDFFAAHGPPS
QAQSPADASFLAASGPGSTPLGALEPPLAGPHAAENPRFTDMISHPDTPSPEPLPGALHP
MPGEVFGGGGPSPPFPMSGSGAYSGALPHPNPELNEAAVW
Download sequence
Identical sequences ENSCPOP00000014441 ENSCPOP00000014441 10141.ENSCPOP00000014441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]