SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015682 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015682
Domain Number 1 Region: 31-151
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.03e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015682   Gene: ENSCPOG00000025621   Transcript: ENSCPOT00000027814
Sequence length 320
Comment pep:known scaffold:cavPor3:scaffold_0:83936879:84386459:1 gene:ENSCPOG00000025621 transcript:ENSCPOT00000027814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLK
RLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMS
HALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRVAPTAPSRGRGGA
IPLPPPPGRGVLTPRGTTVTRGALPVPPIARGVPTPRARGAPTVPGYRAPPPPAHEAYEE
YGYDDGYGEEYEEQTYQAYDHSYAPQTQSVPEYYEYGHGVNEDAYDSYATEEWATTRSSL
KAPPPRSTRGGYREHPYGRY
Download sequence
Identical sequences ENSCPOP00000015682 ENSCPOP00000015682 10141.ENSCPOP00000015682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]