SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015882 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015882
Domain Number 1 Region: 161-231
Classification Level Classification E-value
Superfamily Homeodomain-like 5.13e-20
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 36-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000215
Family LIM domain 0.012
Further Details:      
 
Domain Number 3 Region: 6-34
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000952
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000015882
Domain Number - Region: 97-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0264
Family LIM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015882   Gene: ENSCPOG00000023429   Transcript: ENSCPOT00000022741
Sequence length 349
Comment pep:known scaffold:cavPor3:scaffold_27:7707361:7776793:-1 gene:ENSCPOG00000023429 transcript:ENSCPOT00000022741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQD
YQQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCK
GDYEKEKDLLSSVSPDESDSVKSEDEDGDMKPTKGQGSQSKGSGDDGKDPRRPKRPRTIL
TTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRHQQQQE
QQNSQRLGQEVLSSRMEGMMASYTPLAPPQQQIVAMEQSPYGSSDPFQQGLTPPQMPGND
SIFHDIDSDTSLTSLSDCFLGSSDVGSLQARVGNPIDRLYSMQSSYFAS
Download sequence
Identical sequences ENSCPOP00000015882 10141.ENSCPOP00000015882 ENSCPOP00000015882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]