SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016414 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016414
Domain Number 1 Region: 33-146
Classification Level Classification E-value
Superfamily PH domain-like 4.39e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000488
Further Details:      
 
Domain Number 2 Region: 213-340
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 5.36e-16
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000634
Further Details:      
 
Domain Number 3 Region: 381-396,425-460
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000017
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016414   Gene: ENSCPOG00000023506   Transcript: ENSCPOT00000023899
Sequence length 472
Comment pep:novel scaffold:cavPor3:scaffold_132:2023200:2029278:1 gene:ENSCPOG00000023506 transcript:ENSCPOT00000023899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGPVGGRPGSRAGAAQNIPSSLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAQ
HWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLAPTSFFHTFAGDDC
QVGLNFADEGEAQAFQALVQEKIQKRNQRQSGDRRQRPSAGSVSLGLLTVDIHNPDITSS
RYRGLPAPSPSPADKKRSGKKKISKADIGAPKDFKHVSHVGWDPQNGFDVNNLDPDLRSL
FSRTGNQRRPSSQDGRELPILIYDFIENGGLEAVRQEMRRQDPPPPPPCRGGNQPTRPPV
VGGNKGRSGPLPPVPLGAAPPPPTPRGPPPPGRGGPPPPPPPATGRSGQPPPPLSGAGGG
PVPPPPPPTLGSGGGLAPGGGRGALLDQIRQGIQLNKVRTRRMENLGSVTQGCSVQTLGA
MESAAVQPPPQSSDGLVGALMHVMQKRSRVIHSSDEGEDQAGDDDEDDEWDD
Download sequence
Identical sequences 10141.ENSCPOP00000016414 ENSCPOP00000016414 ENSCPOP00000016414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]