SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016646 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016646
Domain Number 1 Region: 13-139
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-47
Family Regulator of G-protein signaling, RGS 0.00000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016646   Gene: ENSCPOG00000019596   Transcript: ENSCPOT00000026939
Sequence length 152
Comment pep:known scaffold:cavPor3:scaffold_12:29177817:29192898:-1 gene:ENSCPOG00000019596 transcript:ENSCPOT00000026939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKGRCCFYRSPTTETTAWSENMDTLLANQAGLDAFRTFLKSEFSEENVDFWLACEDFKKT
ESAEKIASKARMIYSEFIVADAPKEINIDFSTRDVISRNITEPTVRCFDEAQKLVYSLMA
KDSFPRFLKSEIYRKLVNSQQVGTHKKWLPFL
Download sequence
Identical sequences 10141.ENSCPOP00000016646 ENSCPOP00000016646 ENSCPOP00000016646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]