SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018404 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018404
Domain Number 1 Region: 12-142
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.09e-25
Family Hormone receptor domain 0.00044
Further Details:      
 
Domain Number 2 Region: 137-404
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000705
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018404   Gene: ENSCPOG00000024209   Transcript: ENSCPOT00000028103
Sequence length 450
Comment pep:known scaffold:cavPor3:scaffold_7:44832714:44847867:1 gene:ENSCPOG00000024209 transcript:ENSCPOT00000028103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHGPSDQPLHHLCPQGAWATGLQQECEYLQQIEQQQEECLQQSQVENETGSTGCGRMWDN
LTCWPATPRGQVVVLACPLIFTLFSSIRGLNVSRSCTDEGWTQLEPGPYPAACGLDDNVS
SLDEQQQTLFYNSVKTGYTIGYSLSLATLLVATAILSLFRKLHCTRNYIHTHLFVSFILR
ATAVFIKDWTLFHSEELNHCSQGSVVGCKAAMVFFQYCVMANFFWLLVEGLYLHMLLAVS
FFSERKYFWGYILIGWGVPSTFIMVWTVVRIHIEDVGCWDTINTPVWWIIKGPILTSILV
NFVLFVCIIRILVQKLRPPDVGKSDSSPYSRLAKSTLLLIPLFGVHYVMFAFFPDNFKAE
VKMVFELVVGSFQGFVVAVLYCFLNGEVQAELRRKWRRWNLKGVLGWAPKSQPLWGGSTS
ATCSTQVSMLTRVSPGTRRSSSFQAEASLV
Download sequence
Identical sequences ENSCPOP00000018404 10141.ENSCPOP00000018404 ENSCPOP00000018404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]