SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018621 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018621
Domain Number 1 Region: 32-178
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.46e-23
Family N-acetyl transferase, NAT 0.000000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018621   Gene: ENSCPOG00000026739   Transcript: ENSCPOT00000026196
Sequence length 207
Comment pep:known scaffold:cavPor3:scaffold_193:945633:946780:1 gene:ENSCPOG00000026739 transcript:ENSCPOT00000026196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMQSILPLKREALSLLSGTSESQSCQRRHTLPASEFRCLTLEDAVSVFEIEREAFISVS
GICPLYLDEIRHFLTLCPELSLGWFEEGRLVAFIIGSLWDKKRLTQESLTLHRPGGRMAH
LHVLAVHRTFRQQGKGSILLWRYLQYLGGQPAVRRAVLMCEHVLVPFYEKFGFQAVGPCA
VAVGSLAFTELQCSLRSHAFLRRNSGC
Download sequence
Identical sequences 10141.ENSCPOP00000018621 XP_013007605.1.53824 XP_013007609.1.53824 ENSCPOP00000018621 ENSCPOP00000018621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]