SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018868 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018868
Domain Number 1 Region: 33-113
Classification Level Classification E-value
Superfamily Hormone receptor domain 8.37e-29
Family Hormone receptor domain 0.00000434
Further Details:      
 
Domain Number 2 Region: 85-378
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000915
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018868   Gene: ENSCPOG00000020502   Transcript: ENSCPOT00000026865
Sequence length 411
Comment pep:known scaffold:cavPor3:scaffold_44:6931693:6958367:-1 gene:ENSCPOG00000020502 transcript:ENSCPOT00000026865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAALFHSLLEANCSLVLAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPQSVAGALV
ERPCPEYFNGIKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVN
YLGHCISMVALVAAFLLFLALRSIRCLRNVIHWNLVTTFILRNVTWFLLQLIDHEVHESN
EVWCRCITTVFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKWIFLFIGWCVPCPIII
AWAIGKLYYEDKQCWFGKEPGDLMDYIYQGPIIFVLLINFVFLFNIVRILMTKLRASTTS
ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDELSQIVFIYFNSFLQSFQGFFVSVFYC
FFNGEVRSAVRKRWHRWQDHYSLRVPVARAMSIPTSPTRISFHSIKQTAAV
Download sequence
Identical sequences A0A286XE44
ENSCPOP00000018868 ENSCPOP00000018868 10141.ENSCPOP00000018868 XP_003467913.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]